SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1j70b2 (1j70 B:169-389)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105986Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 protein domains)
    automatically mapped to Pfam PF01747
  6. 2105987Protein ATP sulfurylase catalytic domain [63980] (5 species)
  7. 2105988Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63981] (8 PDB entries)
  8. 2105991Domain d1j70b2: 1j70 B:169-389 [84122]
    Other proteins in same PDB: d1j70a1, d1j70a3, d1j70a4, d1j70b1, d1j70b3, d1j70b4, d1j70c1, d1j70c3
    complexed with na, po4

Details for d1j70b2

PDB Entry: 1j70 (more details), 2.3 Å

PDB Description: crystal structure of yeast atp sulfurylase
PDB Compounds: (B:) ATP sulphurylase

SCOPe Domain Sequences for d1j70b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j70b2 c.26.1.5 (B:169-389) ATP sulfurylase catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ypglrktpaqlrlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvglt
kpgdidhhtrvrvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfiv
grdhagpgknskgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidt
tktrtlnisgtelrrrlrvggeipewfsypevvkilresnp

SCOPe Domain Coordinates for d1j70b2:

Click to download the PDB-style file with coordinates for d1j70b2.
(The format of our PDB-style files is described here.)

Timeline for d1j70b2: