![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
![]() | Superfamily b.122.1: PUA domain-like [88697] (10 families) ![]() |
![]() | Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein) contains extra structures; some similarity to the PK beta-barrel domain |
![]() | Protein ATP sulfurylase N-terminal domain [63802] (5 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (8 PDB entries) |
![]() | Domain d1j70b1: 1j70 B:0-168 [84121] Other proteins in same PDB: d1j70a2, d1j70a3, d1j70b2, d1j70b3, d1j70c2, d1j70c3 |
PDB Entry: 1j70 (more details), 2.3 Å
SCOP Domain Sequences for d1j70b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j70b1 b.122.1.3 (B:0-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} hmpaphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgf lnendyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqd vykpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd
Timeline for d1j70b1: