Lineage for d1j70b1 (1j70 B:0-168)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 569757Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 569758Superfamily b.122.1: PUA domain-like [88697] (7 families) (S)
  5. 569802Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
    contains extra structures; some similarity to the PK beta-barrel domain
  6. 569803Protein ATP sulfurylase N-terminal domain [63802] (4 species)
  7. 569804Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (8 PDB entries)
  8. 569807Domain d1j70b1: 1j70 B:0-168 [84121]
    Other proteins in same PDB: d1j70a2, d1j70a3, d1j70b2, d1j70b3, d1j70c2, d1j70c3

Details for d1j70b1

PDB Entry: 1j70 (more details), 2.3 Å

PDB Description: crystal structure of yeast atp sulfurylase

SCOP Domain Sequences for d1j70b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j70b1 b.122.1.3 (B:0-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
hmpaphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgf
lnendyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqd
vykpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd

SCOP Domain Coordinates for d1j70b1:

Click to download the PDB-style file with coordinates for d1j70b1.
(The format of our PDB-style files is described here.)

Timeline for d1j70b1: