SCOPe 2.06: Domain d1j4jb_: 1j4j B:

Lineage for d1j4jb_ (1j4j B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Tabtoxin resistance protein [82747] (1 species)
   possesses HAT activity

7. Species Pseudomonas syringae [TaxId:317] [82748] (2 PDB entries)

8. Domain d1j4jb_: 1j4j B: [84117]
   complexed with aco

Details for d1j4jb_

PDB Entry: 1j4j, 2.55 Å

PDB Description: crystal structure of tabtoxin resistance protein (form ii) complexed with an acyl coenzyme a

PDB Compounds: (B:) tabtoxin resistance protein

SCOPe Domain Sequences for d1j4jb_:

Sequence; same for both SEQRES and ATOM records:

>d1j4jb_ d.108.1.1 (B:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]}
aqlrrvtaesfahyrhglaqllfetvhggasvgfmadldmqqayawcdglkadiaagsll
lwvvaeddnvlasaqlslcqkpnglnraevqklmvlpsargrglgrqlmdeveqvavkhk
rgllhldteagsvaeafysalaytrvgelpgycatpdgrlhptaiyfktl

Timeline for d1j4jb_:

• d1j4jb_ first appeared in SCOP 1.65
  
• d1j4jb_ appears in SCOPe 2.05
  
• d1j4jb_ appears in SCOPe 2.07
  
• d1j4jb_ appears in the current release, SCOPe 2.08