Lineage for d1j4ia_ (1j4i A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327256Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 327257Superfamily d.26.1: FKBP-like [54534] (2 families) (S)
  5. 327258Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (13 proteins)
  6. 327269Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 327273Species Human (Homo sapiens) [TaxId:9606] [54537] (31 PDB entries)
  8. 327280Domain d1j4ia_: 1j4i A: [84115]
    complexed with tst

Details for d1j4ia_

PDB Entry: 1j4i (more details), 1.8 Å

PDB Description: crystal structure analysis of the fkbp12 complexed with 000308 small molecule

SCOP Domain Sequences for d1j4ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j4ia_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOP Domain Coordinates for d1j4ia_:

Click to download the PDB-style file with coordinates for d1j4ia_.
(The format of our PDB-style files is described here.)

Timeline for d1j4ia_: