SCOPe 2.08: Domain d1j48a_: 1j48 A:

Lineage for d1j48a_ (1j48 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.7: Actinoxanthin-like [49319] (1 family)
   automatically mapped to Pfam PF00960

5. Family b.1.7.1: Actinoxanthin-like [49320] (6 proteins)

6. Protein Antitumor antibiotic C-1027 [63675] (1 species)

7. Species Streptomyces globisporus [TaxId:1908] [63676] (3 PDB entries)

8. Domain d1j48a_: 1j48 A: [84112]
   apo form

Details for d1j48a_

PDB Entry: 1j48, 1.8 Å

PDB Description: crystal structure of apo-c1027

PDB Compounds: (A:) Apoprotein of C1027

SCOPe Domain Sequences for d1j48a_:

Sequence; same for both SEQRES and ATOM records:

>d1j48a_ b.1.7.1 (A:) Antitumor antibiotic C-1027 {Streptomyces globisporus [TaxId: 1908]}
apafsvspasglsdgqsvsvsvsgaaagetyyiaqcapvggqdacnpatatsfttdasga
asfsfvvrksytgstpegtpvgsvdcataacnlgagnsgldlghvaltf

Timeline for d1j48a_:

• d1j48a_ first appeared in SCOP 1.65
  
• d1j48a_ appears in SCOPe 2.07