Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.7: Actinoxanthin-like [49319] (1 family) automatically mapped to Pfam PF00960 |
Family b.1.7.1: Actinoxanthin-like [49320] (6 proteins) |
Protein Antitumor antibiotic C-1027 [63675] (1 species) |
Species Streptomyces globisporus [TaxId:1908] [63676] (3 PDB entries) |
Domain d1j48a_: 1j48 A: [84112] apo form |
PDB Entry: 1j48 (more details), 1.8 Å
SCOPe Domain Sequences for d1j48a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j48a_ b.1.7.1 (A:) Antitumor antibiotic C-1027 {Streptomyces globisporus [TaxId: 1908]} apafsvspasglsdgqsvsvsvsgaaagetyyiaqcapvggqdacnpatatsfttdasga asfsfvvrksytgstpegtpvgsvdcataacnlgagnsgldlghvaltf
Timeline for d1j48a_: