Lineage for d1j3ub_ (1j3u B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010348Protein L-aspartate ammonia lyase [48559] (2 species)
  7. 2010349Species Bacillus sp., ym55-1 [TaxId:1409] [89153] (3 PDB entries)
  8. 2010367Domain d1j3ub_: 1j3u B: [84079]

Details for d1j3ub_

PDB Entry: 1j3u (more details), 2.5 Å

PDB Description: Crystal structure of aspartase from Bacillus sp. YM55-1
PDB Compounds: (B:) aspartase

SCOPe Domain Sequences for d1j3ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3ub_ a.127.1.1 (B:) L-aspartate ammonia lyase {Bacillus sp., ym55-1 [TaxId: 1409]}
vriekdflgekeipkdayygvqtiratenfpitgyrihpelikslgivkksaalanmevg
lldkevgqyivkaadeviegkwndqfivdpiqggagtsinmnanevianralelmgeekg
nyskispnshvnmsqstndafptathiavlsllnqliettkymqqefmkkadefagvikm
grthlqdavpillgqefeayarviardieriantrnnlydinmgatavgtglnadpeyis
ivtehlakfsghplrsaqhlvdatqntdcytevssalkvcminmskiandlrlmasgpra
glseivlparqpgssimpgkvnpvmpevmnqvafqvfgndltitsaseagqfelnvmepv
lffnliqsisimtnvfksftenclkgikaneermkeyveksigiitainphvgyetaakl
areayltgesirelcikygvlteeqlneilnpyemihpgiag

SCOPe Domain Coordinates for d1j3ub_:

Click to download the PDB-style file with coordinates for d1j3ub_.
(The format of our PDB-style files is described here.)

Timeline for d1j3ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1j3ua_