Lineage for d1j3nb2 (1j3n B:250-408)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 403921Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 403922Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 403923Family c.95.1.1: Thiolase-related [53902] (6 proteins)
  6. 403998Protein Beta-ketoacyl-ACP synthase II [53909] (4 species)
  7. 404018Species Thermus thermophilus [TaxId:274] [89792] (1 PDB entry)
  8. 404022Domain d1j3nb2: 1j3n B:250-408 [84077]
    structural genomics
    complexed with cit, mg

Details for d1j3nb2

PDB Entry: 1j3n (more details), 2 Å

PDB Description: Crystal Structure of 3-oxoacyl-(acyl-carrier protein) Synthase II from Thermus thermophilus HB8

SCOP Domain Sequences for d1j3nb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3nb2 c.95.1.1 (B:250-408) Beta-ketoacyl-ACP synthase II {Thermus thermophilus}
riyaelvgfgrsadahhitephpegkgaalamaralkdagiapeqvgyinahgtstpvgd
raevlaikrvfgdhakrlmvsstksmighllgaagaveaiatvqalyhgvipptinledp
dpeldldfvpepreakvdyalsnsfafgghnavlafkrv

SCOP Domain Coordinates for d1j3nb2:

Click to download the PDB-style file with coordinates for d1j3nb2.
(The format of our PDB-style files is described here.)

Timeline for d1j3nb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j3nb1