SCOP 1.67: Domain d1j3nb2: 1j3n B:250-408

Lineage for d1j3nb2 (1j3n B:250-408)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.1: Thiolase-related [53902] (6 proteins)

6. Protein Beta-ketoacyl-ACP synthase II [53909] (4 species)

7. Species Thermus thermophilus [TaxId:274] [89792] (1 PDB entry)

8. Domain d1j3nb2: 1j3n B:250-408 [84077]
   structural genomics
   complexed with cit, mg

Details for d1j3nb2

PDB Entry: 1j3n, 2 Å

PDB Description: Crystal Structure of 3-oxoacyl-(acyl-carrier protein) Synthase II from Thermus thermophilus HB8

SCOP Domain Sequences for d1j3nb2:

Sequence; same for both SEQRES and ATOM records:

>d1j3nb2 c.95.1.1 (B:250-408) Beta-ketoacyl-ACP synthase II {Thermus thermophilus}
riyaelvgfgrsadahhitephpegkgaalamaralkdagiapeqvgyinahgtstpvgd
raevlaikrvfgdhakrlmvsstksmighllgaagaveaiatvqalyhgvipptinledp
dpeldldfvpepreakvdyalsnsfafgghnavlafkrv

Timeline for d1j3nb2:

• d1j3nb2 first appeared in SCOP 1.65
  
• d1j3nb2 appears in SCOP 1.69
  
• d1j3nb2 appears in the current release, SCOPe 2.08