Lineage for d1j3kd_ (1j3k D:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871398Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 871399Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 871400Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (3 proteins)
  6. 871401Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain [55841] (2 species)
  7. 871420Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [88964] (2 PDB entries)
  8. 871422Domain d1j3kd_: 1j3k D: [84073]
    Other proteins in same PDB: d1j3ka_, d1j3kb_
    complexed with ndp, ump, wra; mutant

Details for d1j3kd_

PDB Entry: 1j3k (more details), 2.1 Å

PDB Description: quadruple mutant (n51i+c59r+s108n+i164l) plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with wr99210, nadph, and dump
PDB Compounds: (D:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOP Domain Sequences for d1j3kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3kd_ d.117.1.1 (D:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ddeeeddfvyfnfnkekeeknknsihpndfqiynslkykyhpeyqylniiydimmngnkq
sdrtgvgvlskfgyimkfdlsqyfpllttkklflrgiieellwfirgetngntllnknvr
iweangtrefldnrklfhrevndlgpiygfqwrhfgaeytnmydnyenkgvdqlkniinl
ikndptsrrillcawnvkdldqmalppchilcqfyvfdgklscimyqrscdlglgvpfni
asysifthmiaqvcnlqpaqfihvlgnahvynnhidslkiqlnripypfptlklnpdikn
iedftisdftiqnyvhhekismdmaa

SCOP Domain Coordinates for d1j3kd_:

Click to download the PDB-style file with coordinates for d1j3kd_.
(The format of our PDB-style files is described here.)

Timeline for d1j3kd_: