Lineage for d1j3ka_ (1j3k A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136820Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2136821Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2136822Family c.71.1.1: Dihydrofolate reductases [53598] (4 protein domains)
  6. 2136823Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species)
  7. 2136840Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [88963] (5 PDB entries)
  8. 2136841Domain d1j3ka_: 1j3k A: [84070]
    Other proteins in same PDB: d1j3kc_, d1j3kd_
    complexed with ndp, ump, wra; mutant

Details for d1j3ka_

PDB Entry: 1j3k (more details), 2.1 Å

PDB Description: quadruple mutant (n51i+c59r+s108n+i164l) plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with wr99210, nadph, and dump
PDB Compounds: (A:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d1j3ka_:

Sequence, based on SEQRES records: (download)

>d1j3ka_ c.71.1.1 (A:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mmeqvcdvfdiyaicacckvesknegkknevfnnytfrglgnkgvlpwkcisldmkyfra
vttyvneskyeklkykrckylnketvdnvndmpnskklqnvvvmgrtnwesipkkfkpls
nrinvilsrtlkkedfdedvyiinkvedlivllgklnyykcfilggsvvyqeflekklik
kiyftrinstyecdvffpeineneyqiisvsdvytsnnttldfiiykktnn

Sequence, based on observed residues (ATOM records): (download)

>d1j3ka_ c.71.1.1 (A:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mmeqvcdvfdiyaicacckvesknegkknevfnnytfrglgnkgvlpwkcisldmkyfra
vttyvneskyeklkykrckylnketkklqnvvvmgrtnwesipkkfkplsnrinvilsrt
lkkedfdedvyiinkvedlivllgklnyykcfilggsvvyqeflekklikkiyftrinst
yecdvffpeineneyqiisvsdvytsnnttldfiiykktnn

SCOPe Domain Coordinates for d1j3ka_:

Click to download the PDB-style file with coordinates for d1j3ka_.
(The format of our PDB-style files is described here.)

Timeline for d1j3ka_: