Lineage for d1j3jc_ (1j3j C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1038908Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 1038909Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (1 family) (S)
  5. 1038910Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 1038911Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain [55841] (2 species)
  7. 1038912Species Cryptosporidium hominis [TaxId:237895] [100887] (4 PDB entries)
  8. 1038913Domain d1j3jc_: 1j3j C: [84068]
    Other proteins in same PDB: d1j3ja_, d1j3jb_
    complexed with cp6, ndp, ump; mutant

Details for d1j3jc_

PDB Entry: 1j3j (more details), 2.3 Å

PDB Description: double mutant (c59r+s108n) plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with pyrimethamine, nadph, and dump
PDB Compounds: (C:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d1j3jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j3jc_ d.117.1.1 (C:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, TS domain {Cryptosporidium hominis [TaxId: 237895]}
ddeeeddfvyfnfnkekeeknknsihpndfqiynslkykyhpeyqylniiydimmngnkq
sdrtgvgvlskfgyimkfdlsqyfpllttkklflrgiieellwfirgetngntllnknvr
iweangtrefldnrklfhrevndlgpiygfqwrhfgaeytnmydnyenkgvdqlkniinl
ikndptsrrillcawnvkdldqmalppchilcqfyvfdgklscimyqrscdlglgvpfni
asysifthmiaqvcnlqpaqfihvlgnahvynnhidslkiqlnripypfptlklnpdikn
iedftisdftiqnyvhhekismdmaa

SCOPe Domain Coordinates for d1j3jc_:

Click to download the PDB-style file with coordinates for d1j3jc_.
(The format of our PDB-style files is described here.)

Timeline for d1j3jc_: