Lineage for d1j3jb_ (1j3j B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 843142Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 843143Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families) (S)
  5. 843144Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 843145Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species)
  7. 843162Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [88963] (3 PDB entries)
  8. 843168Domain d1j3jb_: 1j3j B: [84067]
    Other proteins in same PDB: d1j3jc_, d1j3jd_
    complexed with cp6, ndp, ump; mutant

Details for d1j3jb_

PDB Entry: 1j3j (more details), 2.3 Å

PDB Description: Double mutant (C59R+S108N) Plasmodium falciparum dihydrofolate reductase-thymidylate synthase (PfDHFR-TS) complexed with pyrimethamine, NADPH, and dUMP
PDB Compounds: (B:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOP Domain Sequences for d1j3jb_:

Sequence, based on SEQRES records: (download)

>d1j3jb_ c.71.1.1 (B:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mmeqvcdvfdiyaicacckvesknegkknevfnnytfrglgnkgvlpwkcnsldmkyfra
vttyvneskyeklkykrckylnketvdnvndmpnskklqnvvvmgrtnwesipkkfkpls
nrinvilsrtlkkedfdedvyiinkvedlivllgklnyykcfiiggsvvyqeflekklik
kiyftrinstyecdvffpeineneyqiisvsdvytsnnttldfiiykktnn

Sequence, based on observed residues (ATOM records): (download)

>d1j3jb_ c.71.1.1 (B:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mmeqvcdvfdiyaicacckvesknegkknevfnnytfrglgnkgvlpwkcnsldmkyfra
vttyvneskyeklkykrckylklqnvvvmgrtnwesipkkfkplsnrinvilsrtlkked
fdedvyiinkvedlivllgklnyykcfiiggsvvyqeflekklikkiyftrinstyecdv
ffpeineneyqiisvsdvytsnnttldfiiykktnn

SCOP Domain Coordinates for d1j3jb_:

Click to download the PDB-style file with coordinates for d1j3jb_.
(The format of our PDB-style files is described here.)

Timeline for d1j3jb_: