Lineage for d1j3ib_ (1j3i B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2136820Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2136821Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2136822Family c.71.1.1: Dihydrofolate reductases [53598] (4 protein domains)
  6. 2136823Protein Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain [53610] (2 species)
  7. 2136840Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [88963] (5 PDB entries)
  8. 2136844Domain d1j3ib_: 1j3i B: [84063]
    Other proteins in same PDB: d1j3ic_, d1j3id_
    complexed with ndp, ump, wra

Details for d1j3ib_

PDB Entry: 1j3i (more details), 2.33 Å

PDB Description: Wild-type Plasmodium falciparum dihydrofolate reductase-thymidylate synthase (PfDHFR-TS) complexed with WR99210, NADPH, and dUMP
PDB Compounds: (B:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d1j3ib_:

Sequence, based on SEQRES records: (download)

>d1j3ib_ c.71.1.1 (B:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
meqvcdvfdiyaicacckvesknegkknevfnnytfrglgnkgvlpwkcnsldmkyfcav
ttyvneskyeklkykrckylnketvdnvndmpnskklqnvvvmgrtswesipkkfkplsn
rinvilsrtlkkedfdedvyiinkvedlivllgklnyykcfiiggsvvyqeflekklikk
iyftrinstyecdvffpeineneyqiisvsdvytsnnttldfiiykktnn

Sequence, based on observed residues (ATOM records): (download)

>d1j3ib_ c.71.1.1 (B:) Bifunctional enzyme dihydrofolate reductase-thymidylate synthase, DFR domain {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
meqvcdvfdiyaicacckvesknegkknevfnnytfrglgnkgvlpwkcnsldmkyfcav
ttyvneskyeklkykrckylnketvdmpnskklqnvvvmgrtswesipkkfkplsnrinv
ilsrtlkkedfdedvyiinkvedlivllgklnyykcfiiggsvvyqeflekklikkiyft
rinstyecdvffpeineneyqiisvsdvytsnnttldfiiykktnn

SCOPe Domain Coordinates for d1j3ib_:

Click to download the PDB-style file with coordinates for d1j3ib_.
(The format of our PDB-style files is described here.)

Timeline for d1j3ib_: