Lineage for d1j37b_ (1j37 B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 867614Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 867615Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families) (S)
  5. 867707Family d.92.1.5: Neurolysin-like [55505] (4 proteins)
    combines M2, M3 and M32 families of metalloproteases
    the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain
  6. 867714Protein Angiotensin converting enzyme, ACE [82733] (2 species)
    M2 family member; overall fold is similar to that of neurolysin but is less elaborated
  7. 867715Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89991] (3 PDB entries)
  8. 867719Domain d1j37b_: 1j37 B: [84057]
    complexed with mco, zn

Details for d1j37b_

PDB Entry: 1j37 (more details), 2.4 Å

PDB Description: Crystal Structure of Drosophila AnCE
PDB Compounds: (B:) angiotensin converting enzyme

SCOP Domain Sequences for d1j37b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j37b_ d.92.1.5 (B:) Angiotensin converting enzyme, ACE {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
iqakeylenlnkelakrtnveteaawayrsaitdenekkkneisaelakfmkevasdttk
fqwrsyqsedlkrqfkaltklgyaalpeddyaelldtlsamesnfakvkvcdykdstkcd
laldpeieevisksrdheelayywrefydkagtavrsqferyvelntkaaklnnftsgae
awldeyeddtfeqqledifadirplyqqihgyvrfrlrkhygdavvsetgpipmhllgnm
waqqwseiadivspfpekplvdvsaemekqaytplkmfqmgddfftsmnltklpqdfwdk
siiekptdgrdlvchasawdfyliddvrikqctrvtqdqlftvhhelghiqyflqyqhqp
fvyrtganpgfheavgdvlslsvstpkhlekigllkdyvrddearinqlfltaldkivfl
pfaftmdkyrwslfrgevdkanwncafwklrdeysgieppvvrsekdfdapakyhisadv
eylrylvsfiiqfqfyksacikagqydpdnvelpldncdiygsaragaafhnmlsmgask
pwpdaleafngerimsgkaiaeyfeplrvwleaeniknnvhigwitsnkcvsshhhhh

SCOP Domain Coordinates for d1j37b_:

Click to download the PDB-style file with coordinates for d1j37b_.
(The format of our PDB-style files is described here.)

Timeline for d1j37b_: