Lineage for d1j37b1 (1j37 B:23-615)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2963862Family d.92.1.5: Neurolysin-like [55505] (5 proteins)
    combines M2, M3 and M32 families of metalloproteases
    the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain
  6. 2963899Protein Angiotensin converting enzyme, ACE [82733] (2 species)
    M2 family member; overall fold is similar to that of neurolysin but is less elaborated
  7. 2963900Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89991] (3 PDB entries)
  8. 2963904Domain d1j37b1: 1j37 B:23-615 [84057]
    Other proteins in same PDB: d1j37a2, d1j37b2
    complexed with x8z, zn

Details for d1j37b1

PDB Entry: 1j37 (more details), 2.4 Å

PDB Description: Crystal Structure of Drosophila AnCE
PDB Compounds: (B:) angiotensin converting enzyme

SCOPe Domain Sequences for d1j37b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j37b1 d.92.1.5 (B:23-615) Angiotensin converting enzyme, ACE {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
iqakeylenlnkelakrtnveteaawayrsaitdenekkkneisaelakfmkevasdttk
fqwrsyqsedlkrqfkaltklgyaalpeddyaelldtlsamesnfakvkvcdykdstkcd
laldpeieevisksrdheelayywrefydkagtavrsqferyvelntkaaklnnftsgae
awldeyeddtfeqqledifadirplyqqihgyvrfrlrkhygdavvsetgpipmhllgnm
waqqwseiadivspfpekplvdvsaemekqaytplkmfqmgddfftsmnltklpqdfwdk
siiekptdgrdlvchasawdfyliddvrikqctrvtqdqlftvhhelghiqyflqyqhqp
fvyrtganpgfheavgdvlslsvstpkhlekigllkdyvrddearinqlfltaldkivfl
pfaftmdkyrwslfrgevdkanwncafwklrdeysgieppvvrsekdfdapakyhisadv
eylrylvsfiiqfqfyksacikagqydpdnvelpldncdiygsaragaafhnmlsmgask
pwpdaleafngerimsgkaiaeyfeplrvwleaeniknnvhigwitsnkcvss

SCOPe Domain Coordinates for d1j37b1:

Click to download the PDB-style file with coordinates for d1j37b1.
(The format of our PDB-style files is described here.)

Timeline for d1j37b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j37b2