![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.5: Neurolysin-like [55505] (5 proteins) combines M2, M3 and M32 families of metalloproteases the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain |
![]() | Protein Angiotensin converting enzyme, ACE [82733] (2 species) M2 family member; overall fold is similar to that of neurolysin but is less elaborated |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89991] (3 PDB entries) |
![]() | Domain d1j37a1: 1j37 A:23-615 [84056] Other proteins in same PDB: d1j37a2, d1j37b2 complexed with x8z, zn |
PDB Entry: 1j37 (more details), 2.4 Å
SCOPe Domain Sequences for d1j37a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j37a1 d.92.1.5 (A:23-615) Angiotensin converting enzyme, ACE {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} iqakeylenlnkelakrtnveteaawayrsaitdenekkkneisaelakfmkevasdttk fqwrsyqsedlkrqfkaltklgyaalpeddyaelldtlsamesnfakvkvcdykdstkcd laldpeieevisksrdheelayywrefydkagtavrsqferyvelntkaaklnnftsgae awldeyeddtfeqqledifadirplyqqihgyvrfrlrkhygdavvsetgpipmhllgnm waqqwseiadivspfpekplvdvsaemekqaytplkmfqmgddfftsmnltklpqdfwdk siiekptdgrdlvchasawdfyliddvrikqctrvtqdqlftvhhelghiqyflqyqhqp fvyrtganpgfheavgdvlslsvstpkhlekigllkdyvrddearinqlfltaldkivfl pfaftmdkyrwslfrgevdkanwncafwklrdeysgieppvvrsekdfdapakyhisadv eylrylvsfiiqfqfyksacikagqydpdnvelpldncdiygsaragaafhnmlsmgask pwpdaleafngerimsgkaiaeyfeplrvwleaeniknnvhigwitsnkcvss
Timeline for d1j37a1: