Lineage for d1j36b_ (1j36 B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331858Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 331859Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 331937Family d.92.1.5: Neurolysin-like [55505] (3 proteins)
    combines M2, M3 and M32 families of metalloproteases
    the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain
  6. 331938Protein Angiotensin convering enzyme [82733] (2 species)
    M2 family member; overal fold is similar to that of neurolysin but is less elaborated
  7. 331939Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [89991] (3 PDB entries)
  8. 331941Domain d1j36b_: 1j36 B: [84055]
    complexed with lpr, zn

Details for d1j36b_

PDB Entry: 1j36 (more details), 2.4 Å

PDB Description: Crystal Structure of Drosophila AnCE

SCOP Domain Sequences for d1j36b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j36b_ d.92.1.5 (B:) Angiotensin convering enzyme {Fruit fly (Drosophila melanogaster)}
iqakeylenlnkelakrtnveteaawayrsaitdenekkkneisaelakfmkevasdttk
fqwrsyqsedlkrqfkaltklgyaalpeddyaelldtlsamesnfakvkvcdykdstkcd
laldpeieevisksrdheelayywrefydkagtavrsqferyvelntkaaklnnftsgae
awldeyeddtfeqqledifadirplyqqihgyvrfrlrkhygdavvsetgpipmhllgnm
waqqwseiadivspfpekplvdvsaemekqaytplkmfqmgddfftsmnltklpqdfwdk
siiekptdgrdlvchasawdfyliddvrikqctrvtqdqlftvhhelghiqyflqyqhqp
fvyrtganpgfheavgdvlslsvstpkhlekigllkdyvrddearinqlfltaldkivfl
pfaftmdkyrwslfrgevdkanwncafwklrdeysgieppvvrsekdfdapakyhisadv
eylrylvsfiiqfqfyksacikagqydpdnvelpldncdiygsaragaafhnmlsmgask
pwpdaleafngerimsgkaiaeyfeplrvwleaeniknnvhigwitsnkcvsshhhhh

SCOP Domain Coordinates for d1j36b_:

Click to download the PDB-style file with coordinates for d1j36b_.
(The format of our PDB-style files is described here.)

Timeline for d1j36b_: