Lineage for d1j34b_ (1j34 B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614335Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 614336Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 614337Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
    Pfam 00059
  6. 614604Protein Snake coagglutinin beta chain [88867] (9 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 614605Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [88868] (4 PDB entries)
  8. 614606Domain d1j34b_: 1j34 B: [84049]
    Other proteins in same PDB: d1j34a_, d1j34c_
    complexed with ca, cgu, mg

Details for d1j34b_

PDB Entry: 1j34 (more details), 1.55 Å

PDB Description: Crystal Structure of Mg(II)-and Ca(II)-bound Gla Domain of Factor IX Complexed with Binding Protein

SCOP Domain Sequences for d1j34b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j34b_ d.169.1.1 (B:) Snake coagglutinin beta chain {Habu snake (Trimeresurus flavoviridis)}
dcpsdwssyeghcykpfsepknwadaenfctqqhagghlvsfqsseeadfvvklafqtfg
hsifwmglsnvwnqcnwqwsnaamlrykawaeesycvyfkstnnkwrsracrmmaqfvce
fqa

SCOP Domain Coordinates for d1j34b_:

Click to download the PDB-style file with coordinates for d1j34b_.
(The format of our PDB-style files is described here.)

Timeline for d1j34b_: