Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (5 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (10 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Deoxyribose-phosphate aldolase DeoC [69394] (5 species) |
Species Thermus thermophilus [TaxId:274] [89492] (2 PDB entries) |
Domain d1j2wb_: 1j2w B: [84044] |
PDB Entry: 1j2w (more details), 1.5 Å
SCOP Domain Sequences for d1j2wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j2wb_ c.1.10.1 (B:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus} mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk aaggirdretalrmlkagasrlgtssgvalv
Timeline for d1j2wb_: