Lineage for d1j2wa_ (1j2w A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 306689Superfamily c.1.10: Aldolase [51569] (5 families) (S)
    Common fold covers whole protein structure
  5. 306690Family c.1.10.1: Class I aldolase [51570] (8 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 306691Protein Deoxyribose-phosphate aldolase DeoC [69394] (5 species)
  7. 306708Species Thermus thermophilus [TaxId:274] [89492] (2 PDB entries)
  8. 306713Domain d1j2wa_: 1j2w A: [84043]

Details for d1j2wa_

PDB Entry: 1j2w (more details), 1.5 Å

PDB Description: Tetrameric Structure of aldolase from Thermus thermophilus HB8

SCOP Domain Sequences for d1j2wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2wa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus}
mdlaahidhtllkptatleevakaaeealeygfyglcippsyvawvraryphapfrlvtv
vgfplgyqekevkaleaalacargadevdmvlhlgrakagdldyleaevravreavpqav
lkviletgyfspeeiarlaeaairggadflktstgfgprgasledvallvrvaqgraqvk
aaggirdretalrmlkagasrlgtssgvalva

SCOP Domain Coordinates for d1j2wa_:

Click to download the PDB-style file with coordinates for d1j2wa_.
(The format of our PDB-style files is described here.)

Timeline for d1j2wa_: