Lineage for d1j2na_ (1j2n A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014040Fold a.165: Myosin phosphatase inhibitor 17kDa protein, CPI-17 [81789] (1 superfamily)
    4 helices; open up-and-down bundle; flexible N-terminal tail
  4. 2014041Superfamily a.165.1: Myosin phosphatase inhibitor 17kDa protein, CPI-17 [81790] (1 family) (S)
    automatically mapped to Pfam PF05361
  5. 2014042Family a.165.1.1: Myosin phosphatase inhibitor 17kDa protein, CPI-17 [81791] (1 protein)
  6. 2014043Protein Myosin phosphatase inhibitor 17kDa protein, CPI-17 [81792] (1 species)
  7. 2014044Species Pig (Sus scrofa) [TaxId:9823] [81793] (4 PDB entries)
  8. 2014045Domain d1j2na_: 1j2n A: [84019]

Details for d1j2na_

PDB Entry: 1j2n (more details)

PDB Description: Solution structure of CPI-17(22-120) T38D
PDB Compounds: (A:) 17-kDa PKC-potentiated inhibitory protein of PP1

SCOPe Domain Sequences for d1j2na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2na_ a.165.1.1 (A:) Myosin phosphatase inhibitor 17kDa protein, CPI-17 {Pig (Sus scrofa) [TaxId: 9823]}
gpggspgglqkrharvdvkydrrelqrrldvekwidgrleelyrgreadmpdevnidell
eleseeersrkiqgllksctnptenfvqellvklrglhk

SCOPe Domain Coordinates for d1j2na_:

Click to download the PDB-style file with coordinates for d1j2na_.
(The format of our PDB-style files is described here.)

Timeline for d1j2na_: