![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.6: Pre-PUA domain [88802] (4 families) ![]() this domain is found in association with the PUA domain in the C-terminal region of Archaeosine tRNA-guanine transglycosylase and related stand-alone proteins |
![]() | Family d.17.6.1: Archaeosine tRNA-guanine transglycosylase, C2 domain [88803] (1 protein) |
![]() | Protein Archaeosine tRNA-guanine transglycosylase, C2 domain [88804] (1 species) the second of the 3 additional C-terminal domains to the TGT-like domain, also includes "linker" C1 domain |
![]() | Species Archaeon Pyrococcus horikoshii [TaxId:53953] [88805] (4 PDB entries) |
![]() | Domain d1j2bb3: 1j2b B:361-505 [84015] Other proteins in same PDB: d1j2ba1, d1j2ba2, d1j2bb1, d1j2bb2 complexed with mg, zn |
PDB Entry: 1j2b (more details), 3.3 Å
SCOP Domain Sequences for d1j2bb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j2bb3 d.17.6.1 (B:361-505) Archaeosine tRNA-guanine transglycosylase, C2 domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} pitkksalfkisneslrwpvvrrakeraksinerfgelvehpifgrvsrylsltypfaqs eaeddfkiekptkedaikyvmaiaeyqfgegasrafddakvelsktgmprqvkvngkrla tvraddglltlgiegakrlhrvlpy
Timeline for d1j2bb3: