Lineage for d1j2bb2 (1j2b B:7-360)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840113Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 2840114Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 proteins)
  6. 2840115Protein Archaeosine tRNA-guanine transglycosylase, N-terminal domain [75096] (1 species)
  7. 2840116Species Pyrococcus horikoshii [TaxId:53953] [75097] (4 PDB entries)
  8. 2840124Domain d1j2bb2: 1j2b B:7-360 [84014]
    Other proteins in same PDB: d1j2ba1, d1j2ba3, d1j2bb1, d1j2bb3
    protein/RNA complex; complexed with mg, zn

Details for d1j2bb2

PDB Entry: 1j2b (more details), 3.3 Å

PDB Description: Crystal Structure Of Archaeosine tRNA-Guanine Transglycosylase Complexed With lambda-form tRNA(Val)
PDB Compounds: (B:) archaeosine tRNA-guanine transglycosylase

SCOPe Domain Sequences for d1j2bb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2bb2 c.1.20.1 (B:7-360) Archaeosine tRNA-guanine transglycosylase, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
mlkfeikardgagrigklevngkkietpaimpvvnpkqmvvepkelekmgfeiiitnsyi
iykdeelrrkalelgihrmldyngiievdsgsfqlmkygsievsnreiiefqhrigvdig
tfldiptppdapreqavkeleitlsrareaeeikeipmnatiqgstytdlrryaarrlss
mnfeihpiggvvpllesyrfrdvvdivisskmalrpdrpvhlfgaghpivfalavamgvd
lfdsasyalyakddrymtpegtkrldeldyfpcscpvcskytpqelrempkeertrllal
hnlwvikeeikrvkqaikegelwrlvderarshpklysaykrllehytfleefe

SCOPe Domain Coordinates for d1j2bb2:

Click to download the PDB-style file with coordinates for d1j2bb2.
(The format of our PDB-style files is described here.)

Timeline for d1j2bb2: