| Class b: All beta proteins [48724] (126 folds) |
| Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (3 families) ![]() |
| Family b.122.1.1: PUA domain [88698] (2 proteins) RNA-binding domain |
| Protein Archaeosine tRNA-guanine transglycosylase, C3 domain [88701] (1 species) the last of the 3 additional C-terminal domains to the TGT-like domain |
| Species Archaeon Pyrococcus horikoshii [TaxId:53953] [88702] (4 PDB entries) |
| Domain d1j2ba1: 1j2b A:506-582 [84010] Other proteins in same PDB: d1j2ba2, d1j2ba3, d1j2bb2, d1j2bb3 |
PDB Entry: 1j2b (more details), 3.3 Å
SCOP Domain Sequences for d1j2ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j2ba1 b.122.1.1 (A:506-582) Archaeosine tRNA-guanine transglycosylase, C3 domain {Archaeon Pyrococcus horikoshii}
prmrvvvnkeaepfarkgkdvfakfvifadpgirpydevlvvnendellatgqallsgre
mivfqygravkvrkgve
Timeline for d1j2ba1: