Lineage for d1j2ba1 (1j2b A:506-582)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 304923Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 304924Superfamily b.122.1: PUA domain-like [88697] (3 families) (S)
  5. 304925Family b.122.1.1: PUA domain [88698] (2 proteins)
    RNA-binding domain
  6. 304926Protein Archaeosine tRNA-guanine transglycosylase, C3 domain [88701] (1 species)
    the last of the 3 additional C-terminal domains to the TGT-like domain
  7. 304927Species Archaeon Pyrococcus horikoshii [TaxId:53953] [88702] (4 PDB entries)
  8. 304934Domain d1j2ba1: 1j2b A:506-582 [84010]
    Other proteins in same PDB: d1j2ba2, d1j2ba3, d1j2bb2, d1j2bb3

Details for d1j2ba1

PDB Entry: 1j2b (more details), 3.3 Å

PDB Description: Crystal Structure Of Archaeosine tRNA-Guanine Transglycosylase Complexed With lambda-form tRNA(Val)

SCOP Domain Sequences for d1j2ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j2ba1 b.122.1.1 (A:506-582) Archaeosine tRNA-guanine transglycosylase, C3 domain {Archaeon Pyrococcus horikoshii}
prmrvvvnkeaepfarkgkdvfakfvifadpgirpydevlvvnendellatgqallsgre
mivfqygravkvrkgve

SCOP Domain Coordinates for d1j2ba1:

Click to download the PDB-style file with coordinates for d1j2ba1.
(The format of our PDB-style files is described here.)

Timeline for d1j2ba1: