Lineage for d1j25a_ (1j25 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 397005Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 397006Superfamily c.52.1: Restriction endonuclease-like [52980] (22 families) (S)
  5. 397217Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (1 protein)
  6. 397218Protein Putative ATP-dependent RNA helicase Hef, nuclease domain [89717] (1 species)
  7. 397219Species Archaeon Pyrococcus furiosus [TaxId:2261] [89718] (4 PDB entries)
  8. 397223Domain d1j25a_: 1j25 A: [84009]
    complexed with mn; mutant

Details for d1j25a_

PDB Entry: 1j25 (more details), 1.78 Å

PDB Description: crystal structure of archaeal xpf/mus81 homolog, hef from pyrococcus furiosus, nuclease domain, mn cocrystal

SCOP Domain Sequences for d1j25a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j25a_ c.52.1.20 (A:) Putative ATP-dependent RNA helicase Hef, nuclease domain {Archaeon Pyrococcus furiosus}
gvkvvvdsrelrsevvkrlkllgvklevktldvgdyiisedvaierksandliqsiidgg
lfdqvkrlkeaysrpimivegslygirnvhpnairgaiaavtvdfgvpiifsstpeetaq
yifliakreqeer

SCOP Domain Coordinates for d1j25a_:

Click to download the PDB-style file with coordinates for d1j25a_.
(The format of our PDB-style files is described here.)

Timeline for d1j25a_: