Lineage for d1j21c2 (1j21 C:171-395)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212687Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
    unusual fold
  4. 2212688Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) (S)
  5. 2212689Family d.210.1.1: Argininosuccinate synthetase, C-terminal domain [69865] (2 protein domains)
  6. 2212690Protein Argininosuccinate synthetase, C-terminal domain [69866] (3 species)
  7. 2212701Species Thermus thermophilus [TaxId:274] [75594] (7 PDB entries)
  8. 2212724Domain d1j21c2: 1j21 C:171-395 [84003]
    Other proteins in same PDB: d1j21a1, d1j21b1, d1j21c1, d1j21d1
    complexed with atp, cir

Details for d1j21c2

PDB Entry: 1j21 (more details), 2.2 Å

PDB Description: Crystal Structure of Thermus thermophilus HB8 Argininosuccinate Synthetase in complex with ATP and citrulline
PDB Compounds: (C:) Argininosuccinate Synthetase

SCOPe Domain Sequences for d1j21c2:

Sequence, based on SEQRES records: (download)

>d1j21c2 d.210.1.1 (C:171-395) Argininosuccinate synthetase, C-terminal domain {Thermus thermophilus [TaxId: 274]}
pysmdanllhisyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavng
erlspaallqrlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltl
drevlhqrdmlspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvg
rkapkslyrqdlvsfdeaggydqkdaegfikiqalrlrvralver

Sequence, based on observed residues (ATOM records): (download)

>d1j21c2 d.210.1.1 (C:171-395) Argininosuccinate synthetase, C-terminal domain {Thermus thermophilus [TaxId: 274]}
pysmdanllhisyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavng
erlspaallqrlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltl
drevlhqrdmlspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvg
rkapkslyrgydqkdaegfikiqalrlrvralver

SCOPe Domain Coordinates for d1j21c2:

Click to download the PDB-style file with coordinates for d1j21c2.
(The format of our PDB-style files is described here.)

Timeline for d1j21c2: