Lineage for d1j20d2 (1j20 D:171-395)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1445893Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
    unusual fold
  4. 1445894Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) (S)
  5. 1445895Family d.210.1.1: Argininosuccinate synthetase, C-terminal domain [69865] (1 protein)
  6. 1445896Protein Argininosuccinate synthetase, C-terminal domain [69866] (3 species)
  7. 1445907Species Thermus thermophilus [TaxId:274] [75594] (7 PDB entries)
  8. 1445911Domain d1j20d2: 1j20 D:171-395 [83997]
    Other proteins in same PDB: d1j20a1, d1j20b1, d1j20c1, d1j20d1
    complexed with amp, as1, so4

Details for d1j20d2

PDB Entry: 1j20 (more details), 2 Å

PDB Description: Crystal Structure of Thermus thermophilus HB8 Argininosuccinate Synthetase in complex with product
PDB Compounds: (D:) Argininosuccinate Synthetase

SCOPe Domain Sequences for d1j20d2:

Sequence, based on SEQRES records: (download)

>d1j20d2 d.210.1.1 (D:171-395) Argininosuccinate synthetase, C-terminal domain {Thermus thermophilus [TaxId: 274]}
pysmdanllhisyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavng
erlspaallqrlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltl
drevlhqrdmlspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvg
rkapkslyrqdlvsfdeaggydqkdaegfikiqalrlrvralver

Sequence, based on observed residues (ATOM records): (download)

>d1j20d2 d.210.1.1 (D:171-395) Argininosuccinate synthetase, C-terminal domain {Thermus thermophilus [TaxId: 274]}
pysmdanllhisyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavng
erlspaallqrlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltl
drevlhqrdmlspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvg
rkapkslyrqdlvsfgydqkdaegfikiqalrlrvralver

SCOPe Domain Coordinates for d1j20d2:

Click to download the PDB-style file with coordinates for d1j20d2.
(The format of our PDB-style files is described here.)

Timeline for d1j20d2: