Lineage for d1j1zd2 (1j1z D:171-395)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563173Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
    unusual fold
  4. 2563174Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families) (S)
  5. 2563175Family d.210.1.1: Argininosuccinate synthetase, C-terminal domain [69865] (2 protein domains)
  6. 2563176Protein Argininosuccinate synthetase, C-terminal domain [69866] (3 species)
  7. 2563187Species Thermus thermophilus [TaxId:274] [75594] (7 PDB entries)
  8. 2563199Domain d1j1zd2: 1j1z D:171-395 [83989]
    Other proteins in same PDB: d1j1za1, d1j1zb1, d1j1zc1, d1j1zd1
    complexed with asp, atp, cir

Details for d1j1zd2

PDB Entry: 1j1z (more details), 2.1 Å

PDB Description: Crystal Structure of Thermus thermophilus HB8 Argininosuccinate Synthetase in complex with substrate
PDB Compounds: (D:) Argininosuccinate Synthetase

SCOPe Domain Sequences for d1j1zd2:

Sequence, based on SEQRES records: (download)

>d1j1zd2 d.210.1.1 (D:171-395) Argininosuccinate synthetase, C-terminal domain {Thermus thermophilus [TaxId: 274]}
pysmdanllhisyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavng
erlspaallqrlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltl
drevlhqrdmlspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvg
rkapkslyrqdlvsfdeaggydqkdaegfikiqalrlrvralver

Sequence, based on observed residues (ATOM records): (download)

>d1j1zd2 d.210.1.1 (D:171-395) Argininosuccinate synthetase, C-terminal domain {Thermus thermophilus [TaxId: 274]}
pysmdanllhisyeggvledpwaeppkgmfrmtqdpeeapdapeyveveffegdpvavng
erlspaallqrlneiggrhgvgrvdivenrfvgmksrgvyetpggtilyharravesltl
drevlhqrdmlspkyaelvyygfwyaperealqayfdhvarsvtgvarlklykgnvyvvg
rkapkslyrqdlvsfgydqkdaegfikiqalrlrvralver

SCOPe Domain Coordinates for d1j1zd2:

Click to download the PDB-style file with coordinates for d1j1zd2.
(The format of our PDB-style files is described here.)

Timeline for d1j1zd2: