Lineage for d1j1zd1 (1j1z D:1-165)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392101Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 392401Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (5 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 392402Family c.26.2.1: N-type ATP pyrophosphatases [52403] (6 proteins)
  6. 392403Protein Argininosuccinate synthetase, N-terminal domain [69458] (2 species)
  7. 392409Species Thermus thermophilus [TaxId:274] [75167] (7 PDB entries)
  8. 392421Domain d1j1zd1: 1j1z D:1-165 [83988]
    Other proteins in same PDB: d1j1za2, d1j1zb2, d1j1zc2, d1j1zd2
    complexed with asp, atp, cir

Details for d1j1zd1

PDB Entry: 1j1z (more details), 2.1 Å

PDB Description: Crystal Structure of Thermus thermophilus HB8 Argininosuccinate Synthetase in complex with substrate

SCOP Domain Sequences for d1j1zd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1zd1 c.26.2.1 (D:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus}
mkivlaysggldtsiilkwlketyraeviaftadigqgeeveearekalrtgaskaiald
lkeefvrdfvfpmmragavyegyyllgtsiarpliakhlvriaeeegaeaiahgatgkgn
dqvrfeltayalkpdikviapwrewsfqgrkemiayaeahgipvp

SCOP Domain Coordinates for d1j1zd1:

Click to download the PDB-style file with coordinates for d1j1zd1.
(The format of our PDB-style files is described here.)

Timeline for d1j1zd1: