Lineage for d1j1nb_ (1j1n B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2162083Protein Alginate-binding periplasmic protein AlgQ2 [69624] (1 species)
  7. 2162084Species Sphingomonas sp. [TaxId:28214] [69625] (4 PDB entries)
  8. 2162086Domain d1j1nb_: 1j1n B: [83979]
    complexed with ca

Details for d1j1nb_

PDB Entry: 1j1n (more details), 1.6 Å

PDB Description: structure analysis of algq2, a macromolecule(alginate)-binding periplasmic protein of sphingomonas sp. a1., complexed with an alginate tetrasaccharide
PDB Compounds: (B:) AlgQ2

SCOPe Domain Sequences for d1j1nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1nb_ c.94.1.1 (B:) Alginate-binding periplasmic protein AlgQ2 {Sphingomonas sp. [TaxId: 28214]}
keatwvtdkpltlkihmhfrdkwvwdenwpvakesfrltnvklqsvankaatnsqeqfnl
mmasgdlpdvvggdnlkdkfiqygqegafvplnklidqyaphikaffkshpeveraikap
dgniyfipyvpdgvvargyfiredwlkklnlkppqnidelytvlkafkekdpngngkade
vpfidrhpdevfrlvnfwgarssgsdnymdfyidngrvkhpwaetafrdgmkhvaqwyke
glidkeiftrkakareqmfggnlggfthdwfastmtfneglaktvpgfklipiapptnsk
gqrweedsrqkvrpdgwaitvknknpvetikffdfyfsrpgrdisnfgvpgvtydikngk
avfkdsvlkspqpvnnqlydmgaqipigfwqdydyerqwttpeaqagidmyvkgkyvmpg
fegvnmtreeraiydkywadvrtymyemgqawvmgtkdvdktwdeyqrqlklrglyqvlq
mmqqaydrqykn

SCOPe Domain Coordinates for d1j1nb_:

Click to download the PDB-style file with coordinates for d1j1nb_.
(The format of our PDB-style files is described here.)

Timeline for d1j1nb_: