Lineage for d1j1ia_ (1j1i A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134779Family c.69.1.10: Carbon-carbon bond hydrolase [53522] (3 protein domains)
    closely related to the Proline iminopeptidase-like family
  6. 2134800Protein Meta cleavage compound hydrolase CarC [89772] (1 species)
    involved in carbazole degradation
  7. 2134801Species Janthinobacterium sp. J3 [TaxId:213804] [89773] (1 PDB entry)
  8. 2134802Domain d1j1ia_: 1j1i A: [83977]

Details for d1j1ia_

PDB Entry: 1j1i (more details), 1.86 Å

PDB Description: Crystal structure of a His-tagged Serine Hydrolase Involved in the Carbazole Degradation (CarC enzyme)
PDB Compounds: (A:) meta cleavage compound hydrolase

SCOPe Domain Sequences for d1j1ia_:

Sequence, based on SEQRES records: (download)

>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]}
ayverfvnaggvetryleagkgqpvilihgggagaesegnwrnvipilarhyrviamdml
gfgktakpdieytqdrrirhlhdfikamnfdgkvsivgnsmggatglgvsvlhselvnal
vlmgsaglvveihedlrpiinydftregmvhlvkaltndgfkiddaminsrytyatdeat
rkayvatmqwireqgglfydpefirkvqvptlvvqgkddkvvpvetaykfldliddswgy
iiphcghwamiehpedfanatlsflslr

Sequence, based on observed residues (ATOM records): (download)

>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]}
ayverfvnaggvetryleagkgqpvilihgggagaesegnwrnvipilarhyrviamdml
gfgktakpdieytqdrrirhlhdfikamnfdgkvsivgnsmggatglgvsvlhselvnal
vlmgsaglvveydftregmvhlvkaltndgfkiddaminsrytyatdeatrkayvatmqw
ireqgglfydpefirkvqvptlvvqgkddkvvpvetaykfldliddswgyiiphcghwam
iehpedfanatlsflslr

SCOPe Domain Coordinates for d1j1ia_:

Click to download the PDB-style file with coordinates for d1j1ia_.
(The format of our PDB-style files is described here.)

Timeline for d1j1ia_: