Lineage for d1j1ga1 (1j1g A:2-190)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213747Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
    alpha+beta fold
  4. 2213748Superfamily d.124.1: Ribonuclease Rh-like [55895] (2 families) (S)
  5. 2213749Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins)
  6. 2213754Protein Ribonuclease MC1 [55899] (1 species)
  7. 2213755Species Bitter gourd (Momordica charantia) [TaxId:3673] [55900] (8 PDB entries)
    Uniprot P23540
  8. 2213760Domain d1j1ga1: 1j1g A:2-190 [83976]
    Other proteins in same PDB: d1j1ga2
    protein/RNA complex; complexed with 5gp; mutant

Details for d1j1ga1

PDB Entry: 1j1g (more details), 1.6 Å

PDB Description: crystal structure of the rnase mc1 mutant n71s in complex with 5'-gmp
PDB Compounds: (A:) ribonuclease mc1

SCOPe Domain Sequences for d1j1ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1ga1 d.124.1.1 (A:2-190) Ribonuclease MC1 {Bitter gourd (Momordica charantia) [TaxId: 3673]}
dsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditkishl
qsqlntlwpsvlrannqqfwshewtkhgtcsestfnqaayfklavdmrnnydiigalrph
aagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvevvacfaqdgstlidctr
dtcganfif

SCOPe Domain Coordinates for d1j1ga1:

Click to download the PDB-style file with coordinates for d1j1ga1.
(The format of our PDB-style files is described here.)

Timeline for d1j1ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j1ga2