Lineage for d1j1ga_ (1j1g A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 333919Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
    alpha+beta fold
  4. 333920Superfamily d.124.1: Ribonuclease Rh-like [55895] (1 family) (S)
  5. 333921Family d.124.1.1: Ribonuclease Rh-like [55896] (6 proteins)
  6. 333926Protein Ribonuclease MC1 [55899] (1 species)
  7. 333927Species Bitter gourd (Momordica charantia) [TaxId:3673] [55900] (6 PDB entries)
  8. 333932Domain d1j1ga_: 1j1g A: [83976]
    complexed with 5gp; mutant

Details for d1j1ga_

PDB Entry: 1j1g (more details), 1.6 Å

PDB Description: crystal structure of the rnase mc1 mutant n71s in complex with 5'-gmp

SCOP Domain Sequences for d1j1ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1ga_ d.124.1.1 (A:) Ribonuclease MC1 {Bitter gourd (Momordica charantia)}
mdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditkish
lqsqlntlwpsvlrannqqfwshewtkhgtcsestfnqaayfklavdmrnnydiigalrp
haagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvevvacfaqdgstlidct
rdtcganfif

SCOP Domain Coordinates for d1j1ga_:

Click to download the PDB-style file with coordinates for d1j1ga_.
(The format of our PDB-style files is described here.)

Timeline for d1j1ga_: