SCOPe 2.07: Domain d1j1fa1: 1j1f A:1-190

Lineage for d1j1fa1 (1j1f A:1-190)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
   alpha+beta fold

4. Superfamily d.124.1: Ribonuclease Rh-like [55895] (2 families)

5. Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins)

6. Protein Ribonuclease MC1 [55899] (1 species)

7. Species Bitter gourd (Momordica charantia) [TaxId:3673] [55900] (8 PDB entries)
   Uniprot P23540

8. Domain d1j1fa1: 1j1f A:1-190 [83975]
   Other proteins in same PDB: d1j1fa2
   protein/RNA complex; complexed with 5gp; mutant

Details for d1j1fa1

PDB Entry: 1j1f, 1.6 Å

PDB Description: crystal structure of the rnase mc1 mutant n71t in complex with 5'-gmp

PDB Compounds: (A:) ribonuclease mc1

SCOPe Domain Sequences for d1j1fa1:

Sequence; same for both SEQRES and ATOM records:

>d1j1fa1 d.124.1.1 (A:1-190) Ribonuclease MC1 {Bitter gourd (Momordica charantia) [TaxId: 3673]}
fdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditkish
lqsqlntlwptvlrannqqfwshewtkhgtcsestfnqaayfklavdmrnnydiigalrp
haagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvevvacfaqdgstlidct
rdtcganfif

Timeline for d1j1fa1:

• d1j1fa1 first appeared in SCOP 1.65, called d1j1fa_
  
• d1j1fa1 appears in SCOPe 2.06
  
• d1j1fa1 appears in the current release, SCOPe 2.08