Lineage for d1j1ef_ (1j1e F:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1708127Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1709250Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) (S)
    form heterodimeric coiled coil
  5. 1709261Family h.1.25.2: Troponin I [90254] (1 protein)
  6. 1709262Protein Troponin I [90255] (2 species)
  7. 1709266Species Human (Homo sapiens) [TaxId:9606] [90256] (2 PDB entries)
  8. 1709270Domain d1j1ef_: 1j1e F: [83974]
    Other proteins in same PDB: d1j1ea_, d1j1eb_, d1j1ed_, d1j1ee_
    complexed with ca

Details for d1j1ef_

PDB Entry: 1j1e (more details), 3.3 Å

PDB Description: crystal structure of the 52kda domain of human cardiac troponin in the ca2+ saturated form
PDB Compounds: (F:) troponin I

SCOPe Domain Sequences for d1j1ef_:

Sequence, based on SEQRES records: (download)

>d1j1ef_ h.1.25.2 (F:) Troponin I {Human (Homo sapiens) [TaxId: 9606]}
kisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelqdlarq
lharvdkvdeerydieakvtkniteiadltqkifdlrgkfkrptlrrvrisadammqall
garakesldlrahlkqvkkedtekenrevgdw

Sequence, based on observed residues (ATOM records): (download)

>d1j1ef_ h.1.25.2 (F:) Troponin I {Human (Homo sapiens) [TaxId: 9606]}
kisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelqdlarq
lharvdkvdeerydieakvtkniteiadltqkifdlrrisadammqallgarakesldlr
ahlkqvkkedtekenrevgdw

SCOPe Domain Coordinates for d1j1ef_:

Click to download the PDB-style file with coordinates for d1j1ef_.
(The format of our PDB-style files is described here.)

Timeline for d1j1ef_: