Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (35 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) form heterodimeric coiled coil |
Family h.1.25.1: Troponin T [90251] (1 protein) |
Protein Troponin T [90252] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [90253] (2 PDB entries) |
Domain d1j1ee_: 1j1e E: [83973] Other proteins in same PDB: d1j1ea_, d1j1ec_, d1j1ed_, d1j1ef_ complexed with ca |
PDB Entry: 1j1e (more details), 3.3 Å
SCOPe Domain Sequences for d1j1ee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j1ee_ h.1.25.1 (E:) Troponin T {Human (Homo sapiens) [TaxId: 9606]} qterekkkkilaerrkvlaidhlnedqlrekakelwqtiynleaekfdlqekfkqqkyei nvlrnrindnqkvsk
Timeline for d1j1ee_: