Lineage for d1j1eb_ (1j1e B:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1708127Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1709250Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) (S)
    form heterodimeric coiled coil
  5. 1709251Family h.1.25.1: Troponin T [90251] (1 protein)
  6. 1709252Protein Troponin T [90252] (2 species)
  7. 1709256Species Human (Homo sapiens) [TaxId:9606] [90253] (2 PDB entries)
  8. 1709259Domain d1j1eb_: 1j1e B: [83970]
    Other proteins in same PDB: d1j1ea_, d1j1ec_, d1j1ed_, d1j1ef_
    complexed with ca

Details for d1j1eb_

PDB Entry: 1j1e (more details), 3.3 Å

PDB Description: crystal structure of the 52kda domain of human cardiac troponin in the ca2+ saturated form
PDB Compounds: (B:) Troponin T

SCOPe Domain Sequences for d1j1eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1eb_ h.1.25.1 (B:) Troponin T {Human (Homo sapiens) [TaxId: 9606]}
terekkkkilaerrkvlaidhlnedqlrekakelwqtiynleaekfdlqekfkqqkyein
vlrnrindn

SCOPe Domain Coordinates for d1j1eb_:

Click to download the PDB-style file with coordinates for d1j1eb_.
(The format of our PDB-style files is described here.)

Timeline for d1j1eb_: