Lineage for d1j1ea_ (1j1e A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537532Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 537533Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 537713Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 537965Protein Troponin C [47503] (6 species)
  7. 537998Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (8 PDB entries)
  8. 538001Domain d1j1ea_: 1j1e A: [83969]
    Other proteins in same PDB: d1j1eb_, d1j1ec_, d1j1ee_, d1j1ef_

Details for d1j1ea_

PDB Entry: 1j1e (more details), 3.3 Å

PDB Description: crystal structure of the 52kda domain of human cardiac troponin in the ca2+ saturated form

SCOP Domain Sequences for d1j1ea_:

Sequence, based on SEQRES records: (download)

>d1j1ea_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform}
mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidleelkim
lqatgetiteddieelmkdgdknndgridydeflefmkgve

Sequence, based on observed residues (ATOM records): (download)

>d1j1ea_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform}
mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrsmkddkseeelsdlfrmfdknadgyidleelkimlqa
tgetiteddieelmkdgdknndgridydeflefmkgve

SCOP Domain Coordinates for d1j1ea_:

Click to download the PDB-style file with coordinates for d1j1ea_.
(The format of our PDB-style files is described here.)

Timeline for d1j1ea_: