Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.1: Parallel coiled-coil [57943] (27 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) form heterodimeric coiled coil |
Family h.1.25.2: Troponin I [90254] (1 protein) |
Protein Troponin I [90255] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [90256] (2 PDB entries) |
Domain d1j1df_: 1j1d F: [83968] Other proteins in same PDB: d1j1da_, d1j1db_, d1j1dd_, d1j1de_ complexed with ca; mutant |
PDB Entry: 1j1d (more details), 2.61 Å
SCOP Domain Sequences for d1j1df_:
Sequence, based on SEQRES records: (download)
>d1j1df_ h.1.25.2 (F:) Troponin I {Human (Homo sapiens)} kkskisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelqdl arqlharvdkvdeerydieakvtkniteiadltqkifdlrgkfkrptlrrvrisadammq allgar
>d1j1df_ h.1.25.2 (F:) Troponin I {Human (Homo sapiens)} kkskisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelqdl arqlharvdkvdeerydieakvtkniteiadltqkifdlrgkisadammqallgar
Timeline for d1j1df_: