Lineage for d1j1de_ (1j1d E:)

  1. Root: SCOP 1.69
  2. 525081Class h: Coiled coil proteins [57942] (6 folds)
  3. 525082Fold h.1: Parallel coiled-coil [57943] (28 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 525865Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) (S)
    form heterodimeric coiled coil
  5. 525866Family h.1.25.1: Troponin T [90251] (1 protein)
  6. 525867Protein Troponin T [90252] (1 species)
  7. 525868Species Human (Homo sapiens) [TaxId:9606] [90253] (2 PDB entries)
  8. 525870Domain d1j1de_: 1j1d E: [83967]
    Other proteins in same PDB: d1j1da_, d1j1dc_, d1j1dd_, d1j1df_

Details for d1j1de_

PDB Entry: 1j1d (more details), 2.61 Å

PDB Description: crystal structure of the 46kda domain of human cardiac troponin in the ca2+ saturated form

SCOP Domain Sequences for d1j1de_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1de_ h.1.25.1 (E:) Troponin T {Human (Homo sapiens)}
krqterekkkkilaerrkvlaidhlnedqlrekakelwqtiynleaekfdlqekfkqqky
einvlrnrindnqkv

SCOP Domain Coordinates for d1j1de_:

Click to download the PDB-style file with coordinates for d1j1de_.
(The format of our PDB-style files is described here.)

Timeline for d1j1de_: