SCOP 1.69: Domain d1j1dd_: 1j1d D:

Lineage for d1j1dd_ (1j1d D:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (8 PDB entries)

8. Domain d1j1dd_: 1j1d D: [83966]
   Other proteins in same PDB: d1j1db_, d1j1dc_, d1j1de_, d1j1df_

Details for d1j1dd_

PDB Entry: 1j1d, 2.61 Å

PDB Description: crystal structure of the 46kda domain of human cardiac troponin in the ca2+ saturated form

SCOP Domain Sequences for d1j1dd_:

Sequence; same for both SEQRES and ATOM records:

>d1j1dd_ a.39.1.5 (D:) Troponin C {Human (Homo sapiens), cardiac isoform}
ddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqemi
devdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidleelkiml
qatgetiteddieelmkdgdknndgridydeflefmkgve

Timeline for d1j1dd_:

• d1j1dd_ first appeared in SCOP 1.65
  
• d1j1dd_ appears in SCOP 1.67
  
• d1j1dd_ appears in SCOP 1.71
  
• d1j1dd_ appears in the current release, SCOPe 2.08