SCOP 1.65: Domain d1j1dc_: 1j1d C:

Lineage for d1j1dc_ (1j1d C:)

1. Root: SCOP 1.65

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.1: Parallel coiled-coil [57943] (26 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families)
   form heterodimeric coiled coil

5. Family h.1.25.2: Troponin I [90254] (1 protein)

6. Protein Troponin I [90255] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90256] (2 PDB entries)

8. Domain d1j1dc_: 1j1d C: [83965]
   Other proteins in same PDB: d1j1da_, d1j1db_, d1j1dd_, d1j1de_

Details for d1j1dc_

PDB Entry: 1j1d, 2.61 Å

PDB Description: crystal structure of the 46kda domain of human cardiac troponin in the ca2+ saturated form

SCOP Domain Sequences for d1j1dc_:

Sequence, based on SEQRES records:

>d1j1dc_ h.1.25.2 (C:) Troponin I {Human (Homo sapiens)}
akkkskisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelq
dlarqlharvdkvdeerydieakvtkniteiadltqkifdlrgkfkrptlrrvrisadam
mqallg

Sequence, based on observed residues (ATOM records):

>d1j1dc_ h.1.25.2 (C:) Troponin I {Human (Homo sapiens)}
akkkskisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelq
dlarqlharvdkvdeerydieakvtkniteiadltqkifdlrrrvrisadammqallg

Timeline for d1j1dc_:

• d1j1dc_ is new in SCOP 1.65
  
• d1j1dc_ appears in SCOP 1.67
  
• d1j1dc_ appears in the current release, SCOPe 2.08