Lineage for d1j1dc_ (1j1d C:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040519Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) (S)
    form heterodimeric coiled coil
  5. 3040531Family h.1.25.2: Troponin I [90254] (1 protein)
  6. 3040532Protein Troponin I [90255] (2 species)
  7. 3040536Species Human (Homo sapiens) [TaxId:9606] [90256] (2 PDB entries)
  8. 3040537Domain d1j1dc_: 1j1d C: [83965]
    Other proteins in same PDB: d1j1da_, d1j1db_, d1j1dd_, d1j1de_
    complexed with ca

Details for d1j1dc_

PDB Entry: 1j1d (more details), 2.61 Å

PDB Description: crystal structure of the 46kda domain of human cardiac troponin in the ca2+ saturated form
PDB Compounds: (C:) troponin I

SCOPe Domain Sequences for d1j1dc_:

Sequence, based on SEQRES records: (download)

>d1j1dc_ h.1.25.2 (C:) Troponin I {Human (Homo sapiens) [TaxId: 9606]}
akkkskisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelq
dlarqlharvdkvdeerydieakvtkniteiadltqkifdlrgkfkrptlrrvrisadam
mqallg

Sequence, based on observed residues (ATOM records): (download)

>d1j1dc_ h.1.25.2 (C:) Troponin I {Human (Homo sapiens) [TaxId: 9606]}
akkkskisasrklqlktlllqiakqelereaeerrgekgralstraqplelaglgfaelq
dlarqlharvdkvdeerydieakvtkniteiadltqkifdlrrrvrisadammqallg

SCOPe Domain Coordinates for d1j1dc_:

Click to download the PDB-style file with coordinates for d1j1dc_.
(The format of our PDB-style files is described here.)

Timeline for d1j1dc_: