Lineage for d1j1db_ (1j1d B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1969375Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) (S)
    form heterodimeric coiled coil
  5. 1969376Family h.1.25.1: Troponin T [90251] (1 protein)
  6. 1969377Protein Troponin T [90252] (2 species)
  7. 1969381Species Human (Homo sapiens) [TaxId:9606] [90253] (2 PDB entries)
  8. 1969382Domain d1j1db_: 1j1d B: [83964]
    Other proteins in same PDB: d1j1da_, d1j1dc_, d1j1dd_, d1j1df_
    complexed with ca

Details for d1j1db_

PDB Entry: 1j1d (more details), 2.61 Å

PDB Description: crystal structure of the 46kda domain of human cardiac troponin in the ca2+ saturated form
PDB Compounds: (B:) Troponin T

SCOPe Domain Sequences for d1j1db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j1db_ h.1.25.1 (B:) Troponin T {Human (Homo sapiens) [TaxId: 9606]}
qterekkkkilaerrkvlaidhlnedqlrekakelwqtiynleaekfdlqekfkqqkyei
nvlrnrindn

SCOPe Domain Coordinates for d1j1db_:

Click to download the PDB-style file with coordinates for d1j1db_.
(The format of our PDB-style files is described here.)

Timeline for d1j1db_: