Lineage for d1j1da_ (1j1d A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 280804Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 280805Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 280971Family a.39.1.5: Calmodulin-like [47502] (18 proteins)
    Duplication: made with two pairs of EF-hands
  6. 281154Protein Troponin C [47503] (5 species)
  7. 281185Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (7 PDB entries)
  8. 281186Domain d1j1da_: 1j1d A: [83963]
    Other proteins in same PDB: d1j1db_, d1j1dc_, d1j1de_, d1j1df_

Details for d1j1da_

PDB Entry: 1j1d (more details), 2.61 Å

PDB Description: crystal structure of the 46kda domain of human cardiac troponin in the ca2+ saturated form

SCOP Domain Sequences for d1j1da_:

Sequence, based on SEQRES records: (download)

>d1j1da_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform}
mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrsmkddskgkseeelsdlfrmfdknadgyidleelkim
lqatgetiteddieelmkdgdknndgridydeflefmkgve

Sequence, based on observed residues (ATOM records): (download)

>d1j1da_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform}
mddiykaaveqlteeqknefkaafdifvlgaedgsistkelgkvmrmlgqnptpeelqem
idevdedgsgtvdfdeflvmmvrsmkddskseeelsdlfrmfdknadgyidleelkimlq
atgetiteddieelmkdgdknndgridydeflefmkgve

SCOP Domain Coordinates for d1j1da_:

Click to download the PDB-style file with coordinates for d1j1da_.
(The format of our PDB-style files is described here.)

Timeline for d1j1da_: