Lineage for d1j19a3 (1j19 A:2-87)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325381Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 325382Superfamily d.15.1: Ubiquitin-like [54236] (6 families) (S)
  5. 325464Family d.15.1.4: First domain of FERM [54256] (5 proteins)
  6. 325485Protein Radixin [54259] (1 species)
  7. 325486Species Mouse (Mus musculus) [TaxId:10090] [54260] (3 PDB entries)
  8. 325488Domain d1j19a3: 1j19 A:2-87 [83960]
    Other proteins in same PDB: d1j19a1, d1j19a2
    complexed with the icam-2 cytoplasmic peptide, chain B

Details for d1j19a3

PDB Entry: 1j19 (more details), 2.4 Å

PDB Description: Crystal structure of the radxin FERM domain complexed with the ICAM-2 cytoplasmic peptide

SCOP Domain Sequences for d1j19a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j19a3 d.15.1.4 (A:2-87) Radixin {Mouse (Mus musculus)}
pkpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkl
nkkvtqqdvkkenplqfkfrakffpe

SCOP Domain Coordinates for d1j19a3:

Click to download the PDB-style file with coordinates for d1j19a3.
(The format of our PDB-style files is described here.)

Timeline for d1j19a3: