Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.4: First domain of FERM [54256] (6 proteins) |
Protein Radixin [54259] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [54260] (9 PDB entries) |
Domain d1j19a3: 1j19 A:2-87 [83960] Other proteins in same PDB: d1j19a1, d1j19a2, d1j19a4 complexed with the icam-2 cytoplasmic peptide, chain B |
PDB Entry: 1j19 (more details), 2.4 Å
SCOPe Domain Sequences for d1j19a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j19a3 d.15.1.4 (A:2-87) Radixin {Mouse (Mus musculus) [TaxId: 10090]} pkpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkl nkkvtqqdvkkenplqfkfrakffpe
Timeline for d1j19a3: