SCOPe 2.06: Domain d1j19a1: 1j19 A:88-198

Lineage for d1j19a1 (1j19 A:88-198)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (2 families)
   automatically mapped to Pfam PF00373

5. Family a.11.2.1: Second domain of FERM [47032] (9 proteins)

6. Protein Radixin [47035] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47036] (9 PDB entries)

8. Domain d1j19a1: 1j19 A:88-198 [83958]
   Other proteins in same PDB: d1j19a2, d1j19a3, d1j19a4
   complexed with the icam-2 cytoplasmic peptide, chain B

Details for d1j19a1

PDB Entry: 1j19, 2.4 Å

PDB Description: Crystal structure of the radxin FERM domain complexed with the ICAM-2 cytoplasmic peptide

PDB Compounds: (A:) Radixin

SCOPe Domain Sequences for d1j19a1:

Sequence; same for both SEQRES and ATOM records:

>d1j19a1 a.11.2.1 (A:88-198) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl
andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl

Timeline for d1j19a1:

• d1j19a1 first appeared in SCOP 1.65
  
• d1j19a1 appears in SCOPe 2.05
  
• d1j19a1 appears in SCOPe 2.07
  
• d1j19a1 appears in the current release, SCOPe 2.08