Class a: All alpha proteins [46456] (289 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (2 families) automatically mapped to Pfam PF00373 |
Family a.11.2.1: Second domain of FERM [47032] (9 proteins) |
Protein Radixin [47035] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [47036] (9 PDB entries) |
Domain d1j19a1: 1j19 A:88-198 [83958] Other proteins in same PDB: d1j19a2, d1j19a3, d1j19a4 complexed with the icam-2 cytoplasmic peptide, chain B |
PDB Entry: 1j19 (more details), 2.4 Å
SCOPe Domain Sequences for d1j19a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j19a1 a.11.2.1 (A:88-198) Radixin {Mouse (Mus musculus) [TaxId: 10090]} dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl
Timeline for d1j19a1: