Class b: All beta proteins [48724] (165 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.1: Starch-binding domain-like [49452] (2 families) |
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) |
Protein beta-amylase [49462] (1 species) |
Species Bacillus cereus [TaxId:1396] [49463] (15 PDB entries) |
Domain d1j12d1: 1j12 D:418-516 [83954] Other proteins in same PDB: d1j12a2, d1j12b2, d1j12c2, d1j12d2 complexed with ca, ebg |
PDB Entry: 1j12 (more details), 2.1 Å
SCOP Domain Sequences for d1j12d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j12d1 b.3.1.1 (D:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]} tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer niefkafikskdgtvkswqtiqqswnpvplkttshtssw
Timeline for d1j12d1: