SCOP 1.65: Domain d1j11d1: 1j11 D:418-516

Lineage for d1j11d1 (1j11 D:418-516)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.3: Prealbumin-like [49451] (6 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common fold
Superfamily b.3.1: Starch-binding domain [49452] (1 family)
Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
Protein beta-amylase [49462] (1 species)
Species Bacillus cereus [TaxId:1396] [49463] (11 PDB entries)
Domain d1j11d1: 1j11 D:418-516 [83946]
Other proteins in same PDB: d1j11a2, d1j11b2, d1j11c2, d1j11d2
complexed with ca, epg

Details for d1j11d1

PDB Description: beta-amylase from bacillus cereus var. mycoides in complex with alpha- epg

SCOP Domain Sequences for d1j11d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j11d1 b.3.1.1 (D:418-516) beta-amylase {Bacillus cereus}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

SCOP Domain Coordinates for d1j11d1:

Click to download the PDB-style file with coordinates for d1j11d1.
(The format of our PDB-style files is described here.)

Timeline for d1j11d1: